Vertaa PF-selostetta

ORFIRIL injektioneste, liuos 100 mg/ml

Huomioitavaa

Tähän lääkkeeseen kohdistuu lisäseuranta. Tällä tavalla voidaan havaita nopeasti uutta turvallisuutta koskevaa tietoa. Terveydenhuollon ammattilaisia pyydetään ilmoittamaan epäillyistä lääkkeen haittavaikutuksista. Ks. kohdasta Haittavaikutukset, miten haittavaikutuksista ilmoitetaan.

Vaikuttavat aineet ja niiden määrät

Natriumvalproaatti 100 mg/ml.

Yksi 3 ml:n injektionesteampulli sisältää 300 mg natriumvalproaattia.
Yksi 10 ml:n injektionesteampulli sisältää 1000 mg natriumvalproaattia.

Apuaine, jonka vaikutus tunnetaan:
Yksi 3 ml:n ampulli Orfiril 100 mg/ml injektionestettä, liuosta, sisältää 1,81 mmol (41,6 mg) natriumia.
Yksi 10 ml:n ampulli Orfiril 100 mg/ml injektionestettä, liuosta, sisältää 6,0 mmol (138,8 mg) natriumia.

Täydellinen apuaineluettelo, ks. kohta Apuaineet.

Lääkemuoto

Injektioneste, liuos

Kliiniset tiedot

Käyttöaiheet

Orfiril-injektionestettä käytetään epilepsiapotilailla, joilla oraalinen natriumvalproaattihoito ei ole mahdollinen.

Ensisijaisesti yleistyneet epilepsiakohtaukset kuten poissaolokohtaukset (petit mal, poissaolo), myokloniset ja toonis-klooniset kohtaukset.

Natriumvalproaattia voidaan käyttää ainoana lääkkeenä tai yhdessä muun epilepsialääkityksen kanssa muuntyyppisten kohtausten, esim. yksinkertaisten tai monimuotoisten osittaisten kohtausten tai toissijaisesti yleistyneiden osittaisten kohtausten, yhteydessä.

Annostus ja antotapa

Orfiril 100 mg/ml injektioneste on tarkoitettu vain laskimonsisäiseen annostukseen.

Annostus

Annos määritetään iän ja painon mukaan, ja lääkäri valvoo sitä yksilöllisesti käyttäen apunaan pitoisuusmäärityksiä. Pitoisuutta plasmassa pitää seurata tarkasti ja annosta tarvittaessa muuttaa parenteraaliseen hoitoon siirryttäessä, parenteraalisen hoidon aikana ja siirryttäessä takaisin suun kautta tapahtuvaan antoon, erityisesti potilailla, jotka saavat valproaattia suurina annoksina, tai potilailla, jotka saavat valproaatin metaboliaan mahdollisesti vaikuttavia lääkevalmisteita. Hoitoteho saavutetaan yleensä plasmapitoisuuksilla 50 - 100 mg/l (340 ‑ 700 mikromol/l). Keskimääräiset päiväannokset ylläpitohoidon aikana ovat seuraavat:

Lapset 30 mg natriumvalproaattia/painokilo
Nuoret 25 mg natriumvalproaattia/painokilo
Aikuiset 20 mg natriumvalproaattia/painokilo

Lasten ja nuorten suuremmat ylläpitoannokset johtuvat näiden potilaiden suuremmista valproaattipuhdistuma-arvoista.

Hoidon aloitus, tai ylläpitohoidon jatkaminen potilaalla, joka jo käyttää valproaattia:

Lapset ja aikuiset
Uudelle potilaalle aluksi 5–10 mg/kg bolusannos natriumvalproaattia hitaana laskimonsisäisenä (i.v.) injektiona 3-5 minuutin ajan. Annosta suurennetaan 5 mg/kg joka 4–7 vuorokausi kullekin ikäryhmälle suositettuun ylläpitoannokseen saakka tai kunnes tyydyttävä kliininen vaste saavutetaan. Päiväannos jaetaan 3–4 yksittäiseen annokseen. Lääkevalmistetta jo saavalle potilaalle suositellaan hänen tavallisen oraalisesti käyttämänsä kerta-annoksen (mg) verran hitaana i.v.-injektiona 3-5 minuutin ajan tai lyhyenä infuusiona. Antoa jatketaan tarvittaessa toistuvina injektioina joka 6. tunti, tai hitaana i.v.-infuusiona nopeudella 0,6–1 mg/kg/h, kunnes potilas voi ottaa lääkkeensä suun kautta.

Lapsille suositellaan käytettäväksi natriumvalproaattia 30 mg/kg/vrk:n ylläpitoannoksena, mutta ellei riittävää kohtausten hallintaa saavuteta, annos voidaan nostaa tasolle 40 mg/kg/vrk. Tällöin plasman valproiinihappopitoisuuksia pitää seurata usein. On huomattava, että alle 2 kk:n ikäisillä imeväisillä valproiinihapon eliminaation puoliintumisaika voi olla jopa 60 tuntia. Tämä on otettava huomioon, kun annosta suurennetaan ylläpitotasolle. Suosituksen mukainen aikuisten maksimiannos on 2400 mg/vrk.

Munuaisten vajaatoimintaa sairastavilla potilailla plasman vapaan valproiinihapon lisääntyminen pitää ottaa huomioon ja annosta vähennetään sen mukaisesti.

Tytöt ja naiset, jotka voivat tulla raskaaksi
Valproaattihoidon aloittavalla ja sitä valvovalla erikoislääkärillä on oltava kokemusta epilepsian hoidosta. Valproaattihoidon saa aloittaa tytöille ja naisille, jotka voivat tulla raskaaksi, vain, jos muut hoidot ovat tehottomia tai niitä ei siedetä. Valproaattihoito määrätään ja luovutetaan apteekista valproaatin raskaudenehkäisyohjelman mukaisesti (ks. kohdat Vasta-aiheet ja Varoitukset ja käyttöön liittyvät varotoimet).
Valproaattihoitoa määrättäessä on suosittava monoterapiaa ja pienintä tehokasta annosta sekä pitkävaikutteista lääkemuotoa, jos mahdollista. Vuorokausiannos on jaettava vähintään kahteen antokertaan (ks. kohta Raskaus ja imetys).

Antotapa

Orfiril-injektioneste voidaan antaa hitaana i.v.-injektiona tai infuusiona 9 mg/ml (0,9 %) natriumkloridissa tai 50 mg/ml (5 %) glukoosissa.

Hoidon kesto

Laskimonsisäisesti annettava Orfiril-injektioneste korvataan oraalisella hoidolla heti kun se on mahdollista. Kliinisissä tutkimuksissa Orfiril 100 mg/ml injektioneste ‑hoidosta ei ole kokemusta kuin muutaman päivän ajalta.

Vasta-aiheet

Orfiril-injektioneste on vasta-aiheinen seuraavissa tilanteissa:

  • jotka ovat yliherkkiä vaikuttavalle aineelle tai kohdassa Apuaineet mainituille apuaineille
  • joilla on tai on ollut maksasairaus ja/tai on parhaillaan vaikea maksan tai haiman toimintahäiriö
  • joilla on suvussa maksasairautta
  • joiden sisar tai veli on kuollut maksan toimintahäiriöön natriumvalproaattihoidon aikana
  • joilla on porfyria
  • joilla on veren hyytymishäiriö tai trombosytopenia
  • joilla on ureakierron häiriö (ks. kohta Varoitukset ja käyttöön liittyvät varotoimet)
  • naisille, jotka voivat tulla raskaaksi, paitsi jos raskaudenehkäisyohjelman ehdot täyttyvät (ks. kohdat Varoitukset ja käyttöön liittyvät varotoimet ja Raskaus ja imetys).

Valproaatti on vasta-aiheinen potilailla, joilla tiedetään olevan mitokondriaalista polymeraasi gamma (POLG) -entsyymiä koodaavan tuman geenin mutaatioiden aiheuttama mitokondriotauti (esimerkiksi Alpers-Huttenlocherin oireyhtymä), ja alle kaksivuotiailla lapsilla, joilla epäillään olevan POLG-mutaatioon liittyvä sairaus (ks. kohta Varoitukset ja käyttöön liittyvät varotoimet).

Varoitukset ja käyttöön liittyvät varotoimet

Raskaudenehkäisyohjelma

Valproaatti on erittäin teratogeeninen ja kohdussa valproaatille altistuneilla lapsilla on suuri riski saada synnynnäisiä epämuodostumia ja hermostollisia kehityshäiriöitä (ks. kohta Raskaus ja imetys).

Orfiril-injektioneste on vasta-aiheinen seuraavissa tilanteissa:

  • raskauden aikana, paitsi jos sopivaa vaihtoehtoista hoitoa ei ole (ks. kohdat Vasta-aiheet ja Raskaus ja imetys).
  • naisille, jotka voivat tulla raskaaksi, paitsi jos raskaudenehkäisyohjelman ehdot täyttyvät (ks. kohdat Vasta-aiheet ja Raskaus ja imetys).

Raskaudenehkäisyohjelman ehdot:

Lääkkeen määrääjän on varmistettava, että

  • yksilöllinen tilanne arvioidaan jokaisessa tapauksessa potilaan kanssa keskustelemalla, jotta taataan hänen sitoutumisensa, keskustellaan hoitovaihtoehdoista ja varmistetaan, että hän ymmärtää riskit ja tarvittavat toimenpiteet riskien minimoimiseksi
  • raskauden mahdollisuus arvioidaan kaikilta naispotilailta
  • potilas on ymmärtänyt ja tiedostaa synnynnäisten epämuodostumien ja hermostollisten kehityshäiriöiden riskit mukaan lukien näiden riskien suuruuden kohdussa valproaatille altistuneille lapsille
  • potilas ymmärtää ennen hoidon aloitusta ja tarvittaessa hoidon aikana tehtävien raskaustestien tarpeen
  • potilasta neuvotaan raskauden ehkäisyssä ja että potilas kykenee käyttämään tehokasta raskauden ehkäisyä ilman keskeytyksiä koko valproaattihoidon ajan (lisätietoja tämän laatikoidun varoituksen raskauden ehkäisy ‑alakohdassa)
  • potilas ymmärtää, että epilepsian hoitoon perehtyneen erikoislääkärin on tarpeellista tehdä hoitoarvio säännöllisesti (vähintään vuosittain)
  • potilas ymmärtää tarpeen kääntyä lääkärin puoleen heti, kun hän suunnittelee raskautta, jotta varmistetaan oikea-aikainen keskustelu ja siirtyminen vaihtoehtoiseen hoitoon ennen hedelmöitystä ja ennen raskauden ehkäisyn keskeyttämistä
  • potilas ymmärtää raskaustilanteessa kääntyä välittömästi lääkärin puoleen
  • potilas on saanut potilasoppaan
  • potilas on ilmaissut ymmärtäneensä valproaatin käyttöön liittyvät riskit ja tarvittavat varotoimet (vuosittainen riskien hyväksymislomake).

Nämä ehdot koskevat myös naisia, jotka eivät tällä hetkellä ole seksuaalisesti aktiivisia, ellei lääkkeen määräjä arvioi, että on vakuuttavia syitä, jotka osoittavat, että raskauden riskiä ei ole olemassa.

Tytöt

  • Lääkkeen määrääjien on varmistettava, että tyttöjen vanhemmat/huoltajat ymmärtävät tarpeen ottaa yhteyttä erikoislääkäriin, kun valproaattia käyttävän tytön kuukautiset alkavat.
  • Lääkkeen määrääjän on varmistettava, että tyttöjen, joiden kuukautiset ovat alkaneet, vanhemmille/huoltajille tarjotaan kattavasti tietoa synnynnäisten epämuodostumien ja hermostollisten kehityshäiriöiden riskeistä mukaan lukien näiden riskien suuruudesta kohdussa valproaatille altistuneille lapsille.
  • Lääkettä määräävän erikoislääkärin on vuosittain arvioitava valproaattihoidon tarve uudelleen ja harkittava vaihtoehtoista hoitoa potilaille, joiden kuukautiset ovat alkaneet. Jos valproaatti on ainoa sopiva hoito, on keskusteltava tarpeesta käyttää tehokasta raskauden ehkäisyä ja kaikista muista raskaudenehkäisyohjelman ehdoista. Erikoislääkärin on yritettävä tehdä kaikki mahdollinen tyttöjen hoidon vaihtamiseksi vaihtoehtoiseen hoitoon ennen aikuiseksi tuloa.

Raskaustesti
Raskaus on poissuljettava ennen valproaattihoidon aloittamista. Valproaattihoitoa ei saa aloittaa naisille, jotka voivat tulla raskaaksi, ilman terveyspalvelujen tuottajan vahvistamaa negatiivista raskaustestitulosta (raskaustesti plasmasta), jotta poissuljetaan tahaton käyttö raskauden aikana.

Raskauden ehkäisy
Naisten, jotka voivat tulla raskaaksi ja joille on määrätty valproaattia, on käytettävä tehokasta raskauden ehkäisyä ilman keskeytyksiä koko valproaattihoidon ajan. Näille potilaille on tarjottava kattavasti tietoa raskauden ehkäisystä ja heidät on ohjattava saamaan ehkäisyneuvontaa, jos he eivät käytä tehokasta ehkäisymenetelmää. Vähintään yhtä tehokasta ehkäisymenetelmää (mieluummin käyttäjästä riippumatonta muotoa, kuten kohdunsisäistä ehkäisintä tai implanttia) tai kahta toisiaan täydentävää ehkäisymenetelmää, estemenetelmä mukaan lukien, on käytettävä. Ehkäisymenetelmää valittaessa on yksilöllinen tilanne arvioitava jokaisessa tapauksessa potilaan kanssa keskustelemalla, jotta taataan hänen sitoutumisensa ja hoitomyöntyvyys valittuihin menetelmiin. Vaikka hänellä ei olisikaan kuukautisia, hänen on noudatettava kaikkia neuvoja tehokkaasta ehkäisystä.

 

Estrogeenia sisältävät valmisteet

Samanaikainen käyttö estrogeenia sisältävien valmisteiden kanssa, mukaan lukien estrogeenia sisältävät hormonaaliset ehkäisyvalmisteet, voi mahdollisesti johtaa valproaatin tehon heikkenemiseen (ks. kohta Yhteisvaikutukset). Lääkkeen määrääjien on seurattava kliinistä vastetta (kouristuskohtauksia), kun estrogeenia sisältävien valmisteiden käyttö aloitetaan tai lopetetaan.
Valproaatti sen sijaan ei heikennä hormonaalisten ehkäisyvalmisteiden tehoa.

 

Erikoislääkärin tekemä vuosittainen hoidon arvio
Erikoislääkärin on arvioitava vähintään kerran vuodessa, onko valproaatti sopivin hoito potilaalle. Erikoislääkärin on keskusteltava vuosittaisesta riskien hyväksymislomakkeesta ja varmistettava, että potilas on ymmärtänyt sen sisällön hoidon alussa ja jokaisen vuosittaisen hoitoarvion aikana.

Raskauden suunnittelu
Jos lääkettä epilepsian hoitoon käyttävä nainen suunnittelee raskautta, epilepsian hoitoon perehtyneen erikoislääkärin on arvioitava valproaattihoito uudelleen ja harkittava vaihtoehtoista hoitoa. Kaikki mahdollinen on tehtävä hoidon vaihtamiseksi sopivaan vaihtoehtoiseen hoitoon ennen hedelmöitystä ja ennen kuin raskauden ehkäisy keskeytetään (ks. kohta Raskaus ja imetys). Jos vaihto ei ole mahdollista, naiselle on annettava lisäneuvontaa valproaattihoidon syntymättömään lapseen kohdistuvista riskeistä tukemaan hänen perhesuunnittelua koskevaa tietoon perustuvaa päätöstään.

Raskauden alkaessa
Jos valproaattia käyttävä nainen tulee raskaaksi, hänet on välittömästi ohjattava erikoislääkärin vastaanotolle, jotta valproaattihoito arvioidaan uudelleen ja harkitaan vaihtoehtoista hoitoa. Potilaat, jotka ovat altistuneet valproaatille raskaana ollessaan ja heidän kumppaninsa on ohjattava teratologiaan perehtyneen erikoislääkärin vastaanotolle raskausaltistuksen arviointia ja neuvontaa varten (ks. kohta Raskaus ja imetys).


Apteekkihenkilökunnan on varmistettava, että

  • potilaskortti annetaan joka kerta, kun valproaattia luovutetaan apteekista ja että potilaat ymmärtävät potilaskortin sisällön
  • potilaita neuvotaan, että valproaattihoitoa ei saa keskeyttää ja että on välittömästi otettava yhteyttä erikoislääkäriin, jos sunnittelee tai epäilee raskautta.


Koulutusmateriaali

Tukeakseen terveydenhuollon ammattilaisia ja potilaita välttämään raskauden aikaista valproaattialtistusta, myyntiluvanhaltija tarjoaa koulutusmateriaalia varoitusten vahvistamiseksi. Lisäksi annetaan ohjeita valproaatin käytöstä naisille, jotka voivat tulla raskaaksi, ja lisätietoja raskaudenehkäisyohjelmasta. Potilasopas ja potilaskortti on annettava kaikille naisille, jotka voivat tulla raskaaksi ja jotka käyttävät valproaattia.

Vuosittaista riskien hyväksymislomaketta on käytettävä, kun hoito aloitetaan ja erikoislääkärin tekemän valproaattihoidon jokaisen vuosittaisen arvion aikana.

Natriumvalproaattia pitää käyttää vain erityistä varovaisuutta noudattaen (suhteellinen vasta-aihe)

  • pikkulapsilla ja lapsilla, joita on hoidettava useilla samanaikaisesti annettavilla epilepsialääkkeillä
  • potilailla, joilla on luuydinvaurio (edellyttää tarkkaa seurantaa)
  • lapsilla ja nuorilla, jotka ovat monivammaisia ja joilla on vaikeita epilepsian muotoja
  • potilailla, joilla on perinnöllinen entsyymipuutossairaus
  • potilailla, joilla on munuaisten vajaatoiminta ja hypoproteinemia (vapaan valproiinihapon pitoisuuden suureneminen plasmassa on huomioitava ja annosta on pienennettävä sen mukaisesti).

Maksa- ja haimavaurio

Harvinaisissa tapauksissa on todettu vaikea, kuolemaan johtanut maksa- tai haimavaurio erityisesti sellaisilla lapsilla ja nuorilla, jotka ovat saaneet muita epilepsialääkkeitä sisältävää yhdistelmähoitoa. Tämä vaikutus kohdistuu useimmin alle 3‑vuotiaisiin imeväisiin ja pikkulapsiin, joilla on vaikeita epilepsiakohtauksia, erityisesti kun niihin liittyy aivovaurio, kehitysvammaisuus ja/tai perinnöllinen aineenvaihduntasairaus. Natriumvalproaattia tulisi antaa erityistä varovaisuutta noudattaen ja ainoana lääkkeenä tässä potilasryhmässä. Kokemus on osoittanut, että tätä vanhemmilla potilailla (erityisesti yli 10‑vuotiailla) maksasairautta esiintyy huomattavasti harvemmin. Suurimmassa osassa tapauksista maksavaurio todettiin ensimmäisten kuuden hoitokuukauden aikana, erityisesti 2. ja 12. viikon välisenä aikana, ja se oli useimmiten yhteydessä muiden epilepsialääkkeiden samanaikaiseen käyttöön.

Vaikeaa tai kuolemaan johtavaa maksavauriota edeltävästi voi esiintyä ei-spesifisiä oireita, kuten kohtausten tihentymistä, fyysistä huonovointisuutta, pahoinvointia, ruokahaluttomuutta, keskiylävatsan kipua, oksentelua, väsymystä, haluttomuutta, erityyppistä paikallista tai yleistynyttä turvotusta, ikterusta ja letargiaa. Näiden oireiden esiintymistä on seurattava tarkasti.

Natriumvalproaattihoito on keskeytettävä viipymättä, jos potilaan yleiskunnossa on selittämättömiä häiriöitä tai potilaalla on vaikean maksan toimintahäiriön tai haimavaurion kliinisiä oireita tai verenvuototaipumusta. Seerumin aspartaattiaminotransferaasiarvon (ASAT) ja alaniiniaminotransferaasiarvon (ALAT) kolminkertaistuminen, alkalisen fosfataasin ja bilirubiiniarvon nousu ja proteiiniarvojen muutokset sekä maksan transaminaasiarvojen vähäinen suureneminen (1,5‑2‑kertaiseksi) ja samanaikaisesti esiintyvä äkillinen kuumeinen infektio ja selvä koagulaatiohäiriö ovat hoidon keskeyttämisen perusteita.

Itsemurha-ajatukset ja käyttäytyminen

Epilepsialääkkeiden käyttäjillä on raportoitu itsetuhoajatuksia ja -käyttäytymistä lääkkeen käyttötarkoituksesta riippumatta. Satunnaistettujen, plasebokontrolloitujen epilepsialääketutkimusten meta-analyysi osoitti myös itsetuhoajatusten ja -käyttäytymisen riskin vähäistä lisääntymistä. Riskin kasvun mekanismia ei tunneta, eikä lisääntyneen riskin mahdollisuutta voida sulkea pois natriumvalproaattin käyttäjillä. Tästä syystä potilaita pitää seurata itsetuhoajatusten ja -käyttäytymisen varalta, ja asianmukaisen hoidon tarvetta pitää harkita. Potilaita (ja heidän omaisiaan) pitää neuvoa ottamaan yhteyttä lääkäriin, jos itsetuhoajatuksia tai -käyttäytymistä esiintyy.

Potilaat, joilla tiedetään tai epäillään olevan jokin mitokondriotauti

Valproaatin käyttö saattaa tuoda esiin tai pahentaa mitokondriotautien kliinisiä löydöksiä. Näitä tauteja aiheuttavat mitokondriaalisen DNA:n sekä tuman POLG-geenin mutaatiot. Varsinkin valproaatin aiheuttamia akuutteja maksavaurioita ja maksaperäisiä kuolemantapauksia on raportoitu enemmän potilailla, joilla on mitokondriaalista POLG-entsyymiä koodaavan geenin mutaatioiden aiheuttamia perinnöllisiä neurometabolisia oireyhtymiä, esimerkiksi Alpers-Huttenlocherin oireyhtymä.

POLG-entsyymin toimintahäiriöihin liittyviä tauteja on aihetta epäillä, jos potilaan suvussa on POLG-geenivirheitä tai potilaalla itsellään näihin tauteihin viittaavia oireita. Löydöksiä ovat esimerkiksi selittämätön enkefalopatia, vaikeahoitoinen epilepsia (paikallisalkuinen, myoklonioita), status epilepticus, kehitysviiveet, psykomotorinen taantuminen, aksonaalinen sensorimotorinen neuropatia, myopatia, pikkuaivoataksia, silmälihashalvaus tai komplisoitunut migreeni, johon liittyy oksipitaalinen aura. POLG-geenin mutaatioiden tutkimus on tehtävä osana näiden tautien diagnostista arviota nykyisen kliinisen käytännön mukaisesti (ks. kohta Vasta-aiheet).

Hyperammonemia

Natriumvalproaattihoito voi lisätä plasman ammoniakkipitoisuutta (hyperammonemia). Siksi plasman ammoniakki- ja valproiinihappopitoisuutta tulee seurata, jos potilaalla esiintyy apatiaa, uneliaisuutta, oksentelua, hypotoniaa tai kohtausten tihentymistä. Tarvittaessa annostusta tulee pienentää.

Epäiltäessä ureakierron entsyymihäiriötä potilaan metabolia tulee tutkia ennen valproiinihappohoidon aloittamista valproaatin aiheuttaman hyperammonemiariskin takia (ks. kohdat Vasta-aiheet ja Haittavaikutukset).

Kohtauksien paheneminen

Muiden epilepsialääkkeiden tavoin valproaatti voi aiheuttaa joillekin potilaille voinnin parantumisen sijaan ohimenevää kouristusten yleistymistä ja vaikeutumista (mukaan lukien epileptinen sarjakohtaus) tai uudentyyppisten kouristusten ilmaantumista. Jos kouristukset pahentuvat, potilasta on neuvottava ottamaan yhteys lääkäriin välittömästi (ks. kohta Haittavaikutukset).

Lupus erythematosus

Natriumvalproaatin käyttö aiheuttaa vain harvoin immuunijärjestelmän reaktioita. Potilaille, joilla on lupus erythematosuksen oireita, sitä tulee antaa vasta, kun riskit ja hyödyt on punnittu huolellisesti.

Veren hyytymiseen vaikuttavat tekijät

Satunnaisesti, erityisesti suurten annosten käytön yhteydessä, saattaa esiintyä verenvuodon pitkittymistä ja/tai trombosytopeniaa. Siksi lisätutkimukset ovat tarpeen, jos potilaalla esiintyy odottamatonta limakalvoverenvuotoa tai lisääntynyttä mustelmanmuodostustaipumusta.

Erityistä varovaisuutta on noudatettava, jos tromboplastiiniaika on merkitsevästi pidentynyt ja jos potilaan muissa laboratorioarvoissa ilmenee samanaikaisesti muutoksia, kuten fibrinogeeniarvon ja hyytymistekijöiden (ensisijaisesti hyytymistekijä VIII) vähenemistä tai bilirubiiniarvon tai maksaentsyymien lisääntymistä. Trombosyyttien, tromboplastiiniajan, vuotoajan ja fibrinogeeniarvon määrittämistä suositellaan ennen kirurgisia toimenpiteitä ja hammaskirurgiaa.

Jos samanaikaisesti annetaan K-vitamiinin antagonisteja, protrombiiniaikaa on seurattava tarkoin.

Painon nousu ja munasarjojen monirakkulatauti

Kun natriumvalproaattia annetaan naisille ja etenkin nuorille tytöille, heillä on seurattava mahdollista painon nousua ja kuukautiskierron häiriöitä, koska natriumvalproaatti saattaa suurentaa munasarjojen monirakkulataudin riskiä. Tämä sisältää myös hyperandrogenismin ja anovulaation, joihin ei liity havaittavissa olevia lisämunuaisten tai aivolisäkkeen toimintahäiriöitä (ks. kohta Haittavaikutukset).

Karnitiinipalmityylitransferaasin tyyppi II puutos

Potilaita, joilla on karnitiinipalmityylitransferaasin (CPT) tyyppi II puutos, on varoitettava normaalia suuremmasta rabdomyolyysin riskistä natriumvalproaatin käytön yhteydessä.

Natriumvalproaatti ja HI-virus

Natriumvalproaatin on joissakin in vitro ‑tutkimuksissa todettu stimuloivan HI-viruksen replikaatiota. Tämän löydöksen kliinistä merkitystä ei tiedetä.

Karbapeneemit

Valproiinihapon/natriumvalproaatin ja karbapeneemien samanaikaista käyttöä ei suositella (ks. kohta Yhteisvaikutukset).

Diabetesta sairastavat

Natriumvalproaatti metaboloituu osittain ketoaineiksi, joten väärän positiivisen tuloksen mahdollisuus ketoainetestissä on otettava huomioon diabeetikoilla, joilla epäillään ketoasidoosia.

Anto laskimoon

Huolellinen injektiotekniikan noudattaminen on välttämätöntä, jotta injektio ei osu valtimoon, laskimon viereen, ihon alle tai lihakseen, mistä on seurauksena kudoskuolio.

Pediatriset potilaat

Pikkulapsilla natriumvalproaatti on ensisijainen vaikuttava aine vain erikoistapauksissa; sitä tulee käyttää vain suurta varovaisuutta noudattaen ja riski-hyötysuhteen huolellisen arvioinnin jälkeen ja, mikäli mahdollista, ainoana lääkkeenä.

Seuraava kliinisten ja laboratoriotutkimusten aikataulu (ks. alla) koskee lapsia :
Ennen hoidon aloittamista, sen jälkeen kerran kuussa 6 kuukauden ajan ja sitten kahdesti 3 kuukauden välein. Lisäksi suositellaan, että vanhemmat/huoltajat olisivat säännöllisesti yhteydessä hoitavaan lääkäriin puhelimitse laboratoriotutkimusten välisinä aikoina, jotta mahdolliset toksisuus- tai muut kliiniset oireet havaittaisiin varhaisvaiheessa.

Ennen hoidon alkua tehtävät laboratoriokokeet:
Täydellinen verenkuva (TVK), myös trombosyytit, hyytymisarvot (tromboplastiiniaika = P-TT-SPA, fibrinogeeni), seerumin amylaasi, ASAT, ALAT, alkaalinen fosfataasi, kokonaisbilirubiini, proteiini, veren glukoosi.

Hoidon aikana tehtävät laboratoriotutkimukset:
Jos kliinisiä poikkeavuuksia ei ilmene, verenkuvan (myös trombosyytit) ja maksan aminotransferaasien määrittäminen riittää. Joka toiseen tutkimukseen tulisi kuitenkin kuulua hyytymismuuttujia mittaava testi (ks. yllä).

12 hoitokuukauden kuluttua riittää yleensä, että potilas tutkitaan 2‑3 kertaa vuodessa (kliiniset ja laboratoriotutkimukset), jos poikkeavuuksia ei ilmene.

Nuorille ja aikuisille tehtävien kliinisten tutkimusten ja laboratoriokokeiden aikataulu:
Nuorilla ja aikuisillavaikeiden tai jopa kuolemaan johtavien komplikaatioiden riski on vähäinen. Suositus onkin, että ennen hoidon aloittamista tehtyjen (kuten lapsilla, ks. yllä) perusteellisen kliinisen tutkimuksen ja laboratoriotestien jälkeen tarkistettaisiin verenkuva (myös trombosyytit) ja tehtäisiin maksan ja haiman toimintakokeet säännöllisin väliajoin, erityisesti ensimmäisten kuuden kuukauden aikana.

Hoitavan lääkärin ei kuitenkaan pitäisi luottaa yksinomaan veren kemiallisten muuttujien määrityksiin, koska niissä ei välttämättä esiinny poikkeavuutta kaikissa tapauksissa. Potilaan aiemmat sairaudet ja kliiniset lääkärintutkimukset ovat ratkaisevan tärkeitä potilaan arvioinnille. On myös muistettava, että maksaentsyymiarvot voivat joillakin potilailla suurentua väliaikaisesti ilman että ilmenee merkkejä maksan toimintahäiriöstä, erityisesti hoidon alussa.

Natriumsisältö

Tämä lääkevalmiste sisältää 41,6 mg natriumia per 3 ml:n ampulli, joka vastaa 2,1 % WHO:n suosittelemasta natriumin 2 g:n päivittäisestä enimmäissaannista aikuisille.
Tämä lääkevalmiste sisältää 138,8 mg natriumia per 10 ml:n ampulli, joka vastaa 6,9 % WHO:n suosittelemasta natriumin 2 g:n päivittäisestä enimmäissaannista aikuisille

Yhteisvaikutukset

Muiden lääkkeiden vaikutukset natriumvalproaattiin

Jos natriumvalproaatti yhdistetään muihin epilepsialääkkeisiin, on huomattava, että vastavuoroiset vaikutukset plasman pitoisuuksiin ovat mahdollisia: entsyymi-induktiota aiheuttavat epilepsialääkkeet kuten fenobarbitaali, primidoni, fenytoiini ja karbamatsepiini lisäävät valproiinihapon poistumista ja heikentävät siten sen vaikutusta. Valproiinihapon metaboliittien pitoisuus voi nousta, jos samaan aikaan käytetään fenytoiinia tai fenobarbitaalia. Sen vuoksi näillä kahdella lääkkeellä hoidettuja potilaita on seurattava tarkkaan hyperammonemian merkkien ja oireiden varalta.

Felbamaatti lisää vapaan valproiinihapon pitoisuutta plasmassa annoksesta riippuvasti lineaarisesti noin 18 %.

Seerumin valproaattipitoisuuden on raportoitu pienenevän, kun sitä käytetään samanaikaisesti karbapeneemien kanssa. Valproaattipitoisuus laskee noin kahdessa päivässä 60–100 %. Pitoisuuden alenemisen nopeudesta ja suuruudesta johtuen karbapeneemien käyttö valproaattihoidossa olevilla potilailla on vaikea toteuttaa ja siksi sitä tulisi välttää (ks. kohta Varoitukset ja käyttöön liittyvät varotoimet).

Rifampisiini saattaa pienentää valproaattipitoisuutta veressä, jolloin hoitoteho häviää. Valproaattiannosta saattaa siksi olla syytä säätää, kun sitä käytetään samanaikaisesti rifampisiinin kanssa.

Meflokiini lisää valproiinihapon hajoamista, ja sillä voi olla myös spasmogeenista vaikutusta. Samanaikainen anto voi niin ollen aiheuttaa epilepsiakohtauksia.

Proteaasinestäjät, kuten lopinaviiri ja ritonaviiri, pienentävät valproaatin pitoisuutta plasmassa samaan aikaan annettuna.

Valproiinihapon pitoisuus seerumissa voi suurentua simetidiinin, fluoksetiinin ja erytromysiinin samanaikaisen annon yhteydessä. Fluoksetiinin samanaikaisen annon on kuitenkin raportoitu joissakin tapauksissa myös pienentäneen valproiinihappopitoisuutta seerumissa.

Estrogeenia sisältävät valmisteet, mukaan lukien estrogeenia sisältävät hormonaaliset ehkäisyvalmisteet
Estrogeenit ovat valproaatin glukuronisaatioon osallistuvien UDP-glukuronyylitransferaasin (UGT) isoentsyymien induktoreita ja voivat lisätä valproaatin puhdistumaa. Tämä voi johtaa valproaatin pitoisuuden pienenemiseen seerumissa ja mahdollisesti valproaatin tehon heikkenemiseen (ks. kohta Varoitukset ja käyttöön liittyvät varotoimet). Seerumin valproaattipitoisuuksien seurantaa on harkittava.
Valproaatilla sen sijaan ei ole entsyymejä indusoivaa vaikutusta eikä se näin ollen vähennä estrogeenin tai progestatiivisten yhdisteiden tehoa naisilla, jotka käyttävät hormonaalista ehkäisyä.

Natriumvalproaatin vaikutukset muihin lääkkeisiin

Valproaatin aiheuttamalla fenobarbitaalipitoisuuden suurentumisella, joka voi ilmetä vaikeana sedaationa, on erityisen suuri kliininen merkitys. Jos sitä ilmenee, fenobarbitaalin tai primidonin annosta on pienennettävä (primidoni metaboloituu osittain fenobarbitaaliksi).

Valproiinihappo voi suurentaa vapaan (sitoutumattoman) fenytoiinin pitoisuutta huomattavasti ohimenevästi, mutta samanaikaisessa käytössä fenytoiinin kokonaispitoisuus pienenee. Yleensä tällä ei ole kliinistä merkitystä, koska vapaan fenytoiinin määrä pysyy riittävänä. Haittavaikutusriski, etenkin aivovaurioriski (ks. kohta Haittavaikutukset), saattaa kuitenkin suurentua.

Valproiinihappo voi suurentaa karbamatsepiini-10-11-epoksidin pitoisuudet toksiselle alueelle, vaikka karbamatsepiinin pitoisuus olisi terapeuttisella alueella. Kliininen seuranta on aiheellista, etenkin yhdistelmähoitoa aloitettaessa, jolloin annosta on tarvittaessa muutettava.

Valproiinihappo estää lamotrigiinin metaboliaa. Siksi samanaikaisesti käytettävän lamotrigiinin annostusta on pienennettävä. Ihoreaktioiden riski vaikuttaisi olevan suurempi, jos valproiinihappoa sisältäviä lääkevalmisteita käytetään samanaikaisesti lamotrigiinin kanssa.

Natriumvalproaatti suurentaa etosuksimidin pitoisuutta plasmassa, mikä saattaa aiheuttaa haittavaikutuksia. Plasman etosuksimidipitoisuuden tarkkailua suositellaan, kun näitä lääkeaineita käytetään samanaikaisesti.

Valproiinihappo voi nostaa rufinamidin pitoisuutta plasmassa. Tämä nousu riippuu valproiinihapon pitoisuudesta. Erityisesti lasten hoidossa on oltava varovainen, sillä tämä vaikutus on suurempi lapsipopulaatiossa.

Valproiinihappo voi suurentaa felbamaatin pitoisuutta plasmassa noin 50 %. Myös muiden vaikuttavien aineiden kuten kodeiinin metabolia ja proteiiniinsitoutuminen muuttuvat.

Valproaatti syrjäytti terveillä koehenkilöillä diatsepaamin sidoksestaan plasman albumiinista ja esti sen metabolian. Sitoutumattoman diatsepaamin pitoisuus saattaa suurentua yhdistelmähoidossa, ja vapaan diatsepaamin plasmapuhdistuma ja jakautumistilavuus saattavat pienentyä (25 % ja 20 %). Puoliintumisaika pysyy kuitenkin ennallaan.

Valproaatin ja loratsepaamin samanaikainen antaminen terveille koehenkilöille vähensi loratsepaamin puhdistumaa plasmasta 40 %:iin saakka.

Valproiinihappo saattaa suurentaa tsidovudiinipitoisuutta plasmassa, jolloin toksisten reaktioiden riski suurenee.

Samanaikaisessa käytössä nimodipiinipitoisuudet voivat suurentua merkitsevästi metabolian estymisen vuoksi.

Natriumvalproaatti saattaa voimistaa muiden psykotrooppisten lääkevalmisteiden, kuten psykoosilääkkeiden, monoamiinioksidaasin (MAO:n) estäjien, masennuslääkkeiden ja bentsodiatsepiinien, vaikutusta, joten kliinistä seurantaa suositellaan ja annosta on muutettava, jos se on tarkoituksenmukaista.

Valproiinihappo voi pienentää olantsapiinin pitoisuutta plasmassa.

Valproiinihappo voi nostaa propofolin pitoisuutta veressä. Propofoliannoksen pienentämistä on harkittava, jos sitä käytetään yhdessä valproaatin kanssa.

Muut yhteisvaikutukset

Ehkäisytabletteja käyttävillä naisilla ei ole todettu valmisteen pitoisuuden plasmassa pienenevän, koska natriumvalproaatilla ei ole entsyymejä indusoivaa vaikutusta.

Entsyymi-induktiota aiheuttavien lääkevalmisteiden samanaikainen käyttö voi lisätä maksatoksisuutta ja hyperammonemiaa.

Maksatoksisuutta mahdollisesti aiheuttavat lääkevalmisteet, myös alkoholi, voivat pahentaa maksatoksisuutta.

Valproiinihappoa ja klonatsepaamia sisältävien lääkkeiden samanaikaisen käytön yhteydessä esiintyi poissaolokohtauksia potilailla, joilla on aiemmin esiintynyt poissaolotyyppisiä epilepsiakohtauksia.

Valproaatin ja topiramaatin tai asetatsolamidin samanaikaiseen käyttöön on liittynyt enkefalopatiaa ja/tai hyperammonemiaa. Näillä kahdella lääkeaineella hoidettuja potilaita on seurattava tarkoin hyperammoneemisen enkefalopatian oireiden ja löydösten havaitsemiseksi.

Natriumvalproaatin ja antikoagulanttien (esim. varfariinin) tai asetyylisalisyylihapon samanaikainen anto voi lisätä vuototaipumusta. Asetyylisalisyylihappo vähentää myös valproiinihapon sitoutumista plasman proteiineihin. Siksi veren hyytymisarvojen säännöllistä seurantaa suositellaan. Natriumvalproaattia ja asetyylisalisyylihappoa ei pidä antaa samanaikaisesti potilaalle, jolla on kuumetta ja kipua, etenkään imeväisille ja pikkulapsille.

Natriumvalproaatin ja ketiapiinin samanaikainen annostelu voi suurentaa neutropenian/leukopenian riskiä.

Litiumin kanssa yhdistelmänä käytettäessä kummankin vaikuttavan aineen pitoisuutta plasmassa on seurattava säännöllisesti.

Raskaus ja imetys

Valproaatin käyttö on vasta-aiheista epilepsian hoitoon raskauden aikana, paitsi jos sopivaa vaihtoehtoista hoitoa ei ole olemassa. Valproaatin käyttö on vasta-aiheista naisille, jotka voivat tulla raskaaksi, paitsi jos raskaudenehkäisyohjelman ehdot täyttyvät (ks. kohdat Vasta-aiheet ja Varoitukset ja käyttöön liittyvät varotoimet).


Raskaus

Teratogeenisuus ja vaikutukset kehitykseen
Valproaatin käyttö sekä monoterapiana että yhdistelmähoitona, myös muiden epilepsialääkkeiden kanssa käytettäessä, liitetään usein poikkeaviin raskauden lopputuloksiin. Saatavilla olevan tiedon mukaan valproaatin käyttöön yhdistelmähoitona muiden epilepsialääkkeiden kanssa saattaa liittyä suurempi synnynnäisten epämuodostumien riski kuin valproaatin käyttöön monoterapiana.
Sekä eri eläinlajeilla että ihmisillä on osoitettu, että valproaatti läpäisee istukan (ks. kohta Farmakokinetiikka).

Synnynnäiset epämuodostumat
Meta-analyysistä saadut tiedot (jotka sisälsivät rekistereitä ja kohorttitutkimuksia) ovat osoittaneet, että 10,73 % epilepsiaa sairastavien naisten raskauden aikana valproaatille altistuneista lapsista kärsii synnynnäisistä epämuodostumista (95 % CI: 8,16 - 13,29). Tämä suurten epämuodostumien riski on suurempi verrattuna taustaväestöön, joiden riski on noin 2–3 %. Riski riippuu annoksesta, mutta raja-arvoa, jota pienemmillä annoksilla riskiä ei olisi, ei ole pystytty määrittämään.

Saatavilla olevat tiedot osoittavat pienten ja suurten epämuodostumien esiintyvyyden kasvun. Tavallisimpia epämuodostumia ovat hermostoputken kehityshäiriö, kasvojen epämuodostumat, huuli- ja suulakihalkio, ahdaskalloisuus, sydämen, munuaisten ja virtsa- ja sukupuolielinten puutteet, raajojen puutteet (sisältäen värttinäluun puutteet molemmin puolin) sekä useat epämuodostumat eri puolilla kehoa.

Valproaatille altistuminen kohdussa saattaa myös johtaa kuulon heikentymiseen tai kuurouteen korvien ja/tai nenän epämuodostumien vuoksi (sekundäärinen vaikutus) ja/tai kuuloon kohdistuvan suoran toksisuuden vuoksi. Sekä toispuolisesta että molemminpuolisesta kuuroudesta tai kuulon heikentymisestä on raportoitu näissä tapauksissa. Kaikkien tapausten lopputuloksista ei ole raportoitu. Tapauksista, joissa lopputulos raportoitiin, suurin osa oli palautumattomia.

Kehityshäiriöt
Tiedot osoittavat, että kohdussa valproaatille altistuneilla lapsilla voi olla haittavaikutuksia, jotka kohdistuvat älylliseen ja fyysisen kehitykseen. Riski näyttää riippuvan annoksesta, mutta raja-arvoa, jota pienemmillä annoksilla riskiä ei olisi, ei ole pystytty määrittämään saatavilla olevista tiedoista. On epävarmaa, mikä raskauden jakso on riskialtis näille vaikutuksille, ja riskin mahdollisuutta koko raskauden aikana ei voida poissulkea.

Esikouluikäisille, kohdussa valproaatille altistuneille lapsille tehdyt tutkimukset osoittavat, että jopa 30–40 %:lla on ollut viiveitä varhaisessa kehityksessä, kuten viivästynyt puhumisen ja kävelemisen alkaminen, heillä on alentuneet älylliset taidot, heikentyneet kielelliset taidot (puhuminen ja ymmärtäminen) ja muistiongelmia.

Kouluikäisiltä (6-vuotiailta) kohdussa valproaatille altistuneilta lapsilta mitattu älykkyysosamäärä oli keskimäärin 7–10 pistettä alhaisempi kuin niiden lasten, jotka olivat altistuneet muille epilepsialääkkeille. Vaikka sekoittavien tekijöiden osuutta ei voida poissulkea, on olemassa todisteita siitä, että valproaatille altistuneiden lasten älykkyyden heikkenemisen riski ei riipu äidin älykkyysosamäärästä.

Pitkäaikaistuloksia on vain vähän.

Saatavilla olevat tiedot osoittavat, että kohdussa valproaatille altistuneet lapset ovat suuremmassa riskissä saada autismikirjon häiriöitä (noin kolminkertainen riski) ja sairastua lapsuusajan autismiin (noin viisinkertainen riski) verrattuna taustaväestöön.

Rajallinen tutkimustieto viittaa siihen, että kohdussa valproaatille altistuneet lapset saattavat olla alttiimpia tarkkaavuus- ja ylivilkkaushäiriön (ADHD) oireiden kehittymiselle.

Jos nainen suunnittelee raskautta
Jos lääkettä epilepsian hoitoon käyttävä nainen suunnittelee raskautta, epilepsian hoitoon perehtyneen erikoislääkärin on arvioitava valproaattihoito uudelleen ja harkittava vaihtoehtoista hoitoa. Kaikki mahdollinen on tehtävä hoidon vaihtamiseksi sopivaan vaihtoehtoiseen hoitoon ennen hedelmöitystä ja ennen kuin raskauden ehkäisy keskeytetään (ks. kohta Varoitukset ja käyttöön liittyvät varotoimet). Jos vaihto ei ole mahdollista, naiselle on annettava lisäneuvontaa valproaattihoidon syntymättömään lapseen kohdistuvista riskeistä tukemaan hänen perhesuunnittelua koskevaa tietoon perustuvaa päätöstään.

Raskaana olevat naiset
Valproaatin käyttö on vasta-aiheista epilepsian hoitoon raskauden aikana, paitsi jos sopivaa vaihtoehtoista hoitoa ei ole (ks. kohdat Vasta-aiheet ja Varoitukset ja käyttöön liittyvät varotoimet).

Jos valproaattihoitoa käyttävä nainen tulee raskaaksi, hänet on välittömästi ohjattava erikoislääkärin vastaanotolle vaihtoehtoisen hoidon harkitsemiseksi. Raskauden aikana äidin toonis-klooniset epileptiset kohtaukset ja epileptiset sarjakohtaukset (status epilepticus), joihin liittyy hapenpuute, voivat sisältää erityisen kuolemanriskin äidille ja syntymättömälle lapselle.

Jos raskaana olevalle naiselle on poikkeuksellisesti annettava valproaattia epilepsian hoitoon valproaatin raskaudenaikaisista tunnetuista riskeistä huolimatta ja vaihtoehtoisen hoidon huolellisen harkinnan jälkeen, on suositeltavaa:

  • käyttää pienintä tehokasta annosta ja jakaa valproaatin vuorokausiannos useaksi pieneksi annokseksi, jotka otetaan päivän kuluessa. Pitkävaikutteiset lääkemuodot voivat olla muita lääkemuotoja parempi vaihtoehto suurten plasman huippupitoisuuksien välttämiseksi (ks. kohta Annostus ja antotapa).

Kaikki potilaat, jotka ovat altistuneet valproaatille raskaana ollessaan ja heidän kumppaninsa on ohjattava teratologiaan perehtyneen erikoislääkärin vastaanotolle raskausaltistuksen arviointia ja neuvontaa varten. Erityinen raskaudenaikainen seuranta on toteutettava mahdollisten hermostoputken kehityshäiriöiden tai muiden epämuodostumien esiintymisen havaitsemiseksi. Foolihappolisä ennen raskautta saattaa pienentää kaikissa raskauksissa esiintyvien hermostoputken kehityshäiriöiden riskiä. Saatavilla oleva näyttö ei kuitenkaan viittaa siihen, että foolihappo estäisi valproaattialtistuksesta johtuvia synnynnäisiä poikkeavuuksia tai epämuodostumia.

Naiset, jotka voivat tulla raskaaksi

Estrogeenia sisältävät valmisteet
Estrogeenit, mukaan lukien estrogeenia sisältävät hormonaaliset ehkäisyvalmisteet, voivat lisätä valproaatin puhdistumaa, mikä voi johtaa valproaatin pitoisuuden pienenemiseen seerumissa ja mahdollisesti valproaatin tehon heikkenemiseen (ks. kohdat Varoitukset ja käyttöön liittyvät varotoimet ja Yhteisvaikutukset).

Riskit vastasyntyneelle

  • Vastasyntyneiltä, joiden äidit ovat käyttäneet valproaattia raskauden aikana, on raportoitu verenvuoto-oireyhtymätapauksia erittäin harvoin. Tämä verenvuoto-oireyhtymä liittyy trombosytopeniaan, hypofibrinogenemiaan ja/tai muiden hyytymistekijöiden vähenemiseen. On raportoitu myös afibrinogenemiaa, joka voi olla kuolemaan johtava. Tämä oireyhtymä on kuitenkin erotettava K-vitamiinitekijöiden vähenemisestä, jota voivat aiheuttaa fenobarbitaali ja muut entsyymi-induktorit. Siksi on tutkittava vastasyntyneen verihiutalemäärä, plasman fibrinogeenipitoisuus, hyytymiskokeet ja hyytymistekijät.
  • Vastasyntyneiltä, joiden äidit ovat käyttäneet valproaattia raskauden viimeisen kolmanneksen aikana, on raportoitu hypoglykemiatapauksia.
  • Vastasyntyneiltä, joiden äidit ovat käyttäneet valproaattia raskauden aikana, on raportoitu kilpirauhasen vajaatoimintatapauksia.
  • Vastasyntyneille, joiden äidit ovat käyttäneet valproaattia raskauden viimeisen kolmanneksen aikana, voi ilmaantua vieroitusoireyhtymä (kuten erityisesti ahdistuneisuutta, ärtyvyyttä, yliärtyvyyttä, hermostuneisuutta, hyperkinesiaa, toonisuuden häiriöitä, vapinaa, kouristuksia ja ruokintaongelmia).

Imetys

Valproaatti erittyy äidinmaitoon. Pitoisuus äidinmaidossa on 1–10 % äidin seerumin valproaattipitoisuudesta. Hoitoa saaneiden äitien rintaruokituilla vastasyntyneillä/lapsilla on todettu hematologisia häiriöitä (ks. kohta Haittavaikutukset).

On päätettävä keskeytetäänkö rintaruokinta vai keskeytetäänkö/pidättäydytäänkö Orfiril-hoidosta ottaen huomioon rintaruokinnan hyödyt lapselle ja hoidon hyödyt äidille.

Hedelmällisyys

Valproaattia käyttäneillä naisilla on raportoitu amennorreaa, monirakkulaisia munasarjoja ja suurentunutta testosteronitasoa (ks. kohta Haittavaikutukset). Valproaatin anto voi heikentää myös miesten hedelmällisyyttä (ks. kohta Haittavaikutukset). Tapausraportit osoittavat, että vaikutukset hedelmällisyyteen menevät ohi hoidon lopettamisen jälkeen.

Vaikutus ajokykyyn ja koneiden käyttökykyyn

Reaktioaika saattaa pidentyä natriumvalproaattihoidon aikana. Tämä tulee ottaa huomioon erityistä tarkkaavaisuutta vaativissa tehtävissä, esim. ajettaessa autolla tai käytettäessä koneita.

Haittavaikutukset

Kaikkia suun kautta otettavan valproaatin käytön yhteydessä esiintyviä haittavaikutuksia tavataan myös käytettäessä Orfiril-injektionestettä. Parenteraalisen annon yhteydessä injektiokohdassa voi esiintyä polttelua.

Natriumvalproaatin yleisimmin ilmoitettuja haittavaikutuksia ovat mahasuolikanavan häiriöt, joita esiintyy noin 20 %:lla potilaista. Yleensä ne ovat luonteeltaan lieviä tai keskivaikeita, ohimeneviä ja harvoin vaativat hoidon keskeyttämistä.
Vaikeita (jopa kuolemaan johtavia) maksavaurioita on havaittu varsinkin lapsilla, jotka saavat suuria annoksia tai muita epilepsialääkkeitä sisältävää yhdistelmähoitoa.

Haittavaikutukset on luokiteltu MedDRA-yleisyysluokituksen mukaisesti:
Hyvin yleinen (≥ 1/10)
Yleinen (≥ 1/100, < 1/10)
Melko harvinainen (≥ 1/1 000, < 1/100)
Harvinainen (≥ 1/10 000, < 1/1 000)
Hyvin harvinainen (< 1/10 000)
Tuntematon (koska saatavissa oleva tieto ei riitä arviointiin)

 

Hyvin yleinen

Yleinen

Melko harvinainen

Harvinainen

Hyvin harvinainen

Tuntematon

Hyvän- ja pahanlaatuiset kasvaimet (mukaan lukien kystat ja polyypit)

   

Myelodysplastinen oireyhtymä

  

Veri ja imukudos

 

Trombosytopenia (ks. kohta Varoitukset ja käyttöön liittyvät varotoimet), leukopenia, anemia, verenvuoto

Pansytopenia

Luuytimen häiriöt, punasolulinjan aplasia, agranulosytoosi, makrosyyttinen anemia, makrosytoosi

Fibrinogeeni- ja/tai hyytymistekijä VIII:n pitoisuuden väheneminen, trombosyyttiaggregaation heikkeneminen, vuotoajan piteneminen, lymfosytopenia, neutropenia, eosinofilia

 

Immuunijärjestelmä

  

Angioedeema

Lupus erythematosus, lääkeaineihottuma, johon liittyy eosinofiliaa ja systeemisiä oireita (DRESS-oireyhtymä)

 

Allergiset reaktiot (ks. myös Iho ja ihonalainen kudos)

Umpieritys

  

Hyperandrogenismi (hirsutismi, virilismi, akne, miestyyppinen kaljuus, androgeenien liikatuotanto)

Kilpirauhasen vajaatoiminta

  

Aineenvaihdunta ja ravitsemus

Hyper-ammo-nemia*1

Painon lisääntyminen (munasarjojen monirakkulataudin riskitekijä, tarkka seuranta on tarpeen, ks. kohta Varoitukset ja käyttöön liittyvät varotoimet) tai painon väheneminen, ruokahalun väheneminen tai lisääntyminen, hyperinsulinemia, hyponatremia, HDL-kolesteroli-pitoisuuden pieneneminen

Antidiureettisen hormonin epäasianmukaisen erityksen oireyhtymä (SIADH)

Insuliininkaltaista kasvutekijää sitovan proteiinin I pitoisuuksien pieneneminen, lihavuus

  

Psyykkiset häiriöt

 

Aggressiivisuus*2, agitaatio*2, keskittymisvaikeudet*2, sekavuus, hallusinaatiot, ruokahaluttomuus

Ärtyneisyys

Epänormaali käyttäytyminen*2, psykomotorinen ylivilkkaus*2, oppimisvaikeudet*2, nukahtamisvaikeudet

Psykoosi, ahdistuneisuus, masennus

 

Hermosto

Vapina

Päänsärky , tokkuraisuus, uneliaisuus, parestesiat, muistin heikkeneminen, nystagmus, huimaus, horros*3, kouristukset*3, ekstrapyramidaaliset häiriöt

Kohtauksien paheneminen, päänsärky, yliaktiivisuus, spastisuus, ataksia, letargia*3 enkefalopatia*4, parkinsonistinen oireyhtymä (korjaantuva). Ohimenevä tajuttomuus, johon liittyy joissakin tapauksissa kohtaustiheyden nousu. Makuaistin muutos*5.

Kognitiivinen häiriö, aivoatrofiaan liittyvä dementia (korjautuu hoidon lopettamisen jälkeen), diplopia, dysartria, koordinaatiohäiriöt

 

Sedaatio

Kuulo ja tasapainoelin

    

Kuulonmenetys (korjaantuva tai korjaantumaton), tinnitus

 

Verisuonisto

  

Vaskuliitti

   

Hengityselimet, rintakehä ja välikarsina

  

(Eosinofiilinen) pleuraeffuusio

   

Ruoansulatuselimistö

Kipu*6, pahoinvointi*6, oksentelu

Ripuli*6, ienten häiriöt (lähinnä ienhyperplasia), stomatiitti

Pankreatiitti (johtaa toisinaan kuolemaan, ks. kohta Varoitukset ja käyttöön liittyvät varotoimet)

Syljen liikaeritys

  

Maksa ja sappi

 

Maksan toimintakokeiden muutokset

Vaikea maksavaurio*7, mukaan lukien maksan vajaatoiminta (ks. kohta Varoitukset ja käyttöön liittyvät varotoimet)

   

Iho ja ihonalainen kudos

 

Yliherkkyys, väliaikainen hiustenlähtö, hiusten haalistuminen ja kihartuminen, kynnen ja kynsipedin häiriöt

Eksanteema

Stevens-Johnsonin oireyhtymä, toksinen epidermaalinen nekrolyysi, erythema multiforme

 

Hirsutismi (esim. munasarjojen monirakkulataudin seurauksena)

Luusto, lihakset ja sidekudos

  

Luun mineraalitiheyden lasku*8, osteopenia*8, osteoporoosi*8 ja luunmurtumat*8

Rabdomyolyysi (ks. kohta Varoitukset ja käyttöön liittyvät varotoimet)

  

Munuaiset ja virtsatiet

 Virtsanpidätyskyvyttömyys

Munuaisten vajaatoiminta

Fanconin oireyhtymä (johon liittyy metabolinen asidoosi, fosfaturia, aminoasiduria, glykosuria, jotka korjautuvat hoidon lopettamisen jälkeen), enureesi, tubulointerstitiaalinen nefriitti

 

, Munuaisten toiminnan heikkeneminen.

Sukupuolielimet ja rinnat

 

Kuukautisten puuttuminen

Dysmenorrea

Munasarjojen monirakkulatauti, miehen hedelmättömyys

 

Siittiöiden muodostumisen häiriöt (vähentynyt siittiömäärä ja/tai siittiöiden liikkuvuus)

Synnynnäiset ja perinnölliset/geneettiset häiriöt

Synnynnäiset epämuodostumat ja kehityshäiriöt (ks. kohdat Varoitukset ja käyttöön liittyvät varotoimet ja Raskaus ja imetys).

     

Yleisoireet ja antopaikassa todettavat haitat

  

Hypotermia

Pistoskohdan tulehdus ja kipu*5, edeema

 

Kudoshäiriöitä voi esiintyä, jos pistos annetaan vahingossa valtimoon tai laskimon ulkopuolelle*5. Huimausta voi esiintyä laskimoon annon yhteydessä*5.

Tutkimukset

   

Hyytymistekijöiden väheneminen, poikkeavat tulokset hyytymiskokeissa (esim. protrombiiniajan piteneminen, aktivoidun partiaalisen tromboplastiiniajan piteneminen, trombiiniajan piteneminen, INR-arvon suureneminen, ks. kohdat Varoitukset ja käyttöön liittyvät varotoimet ja Raskaus ja imetys), biotiinin tai biotinidaasin puutos

 

Poikkeavuudet kilpirauhasen toimintakokeissa

*1 Yksittäisiä, kohtalaisia hyperammonemiatapauksia ilman muutoksia maksan toimintakokeissa saattaa esiintyä usein, mutta ne ovat yleensä ohimeneviä eivätkä yleensä edellytä hoidon keskeyttämistä. Kliinisinä oireina saattaa kuitenkin esiintyä oksentelua, ataksiaa ja lisääntynyttä tajunnan hämärtymistä. Jos tällaisia oireita esiintyy, Orfiril-hoito on lopetettava.

*2 Näitä haittavaikutuksia on todettu pääasiassa lapsilla.

*3 Kouristuskohtausten lisääntymiseen on liittynyt horrostiloja ja letargiaa, jotka häviävät annoksen pienentämisen tai lääkehoidon lopettamisen jälkeen. Suurin osa näistä tapauksista esiintyi yhdistelmähoidon aikana (etenkin fenobarbitaalin tai topiramaatin kanssa) tai annoksen nopean suurentamisen jälkeen.

*4 Melko harvinaisissa tapauksissa on havaittu tuntemattomasta syystä johtuvaa enkefalopatiaa, joka ilmeni pian valproiinihappoa sisältävän lääkevalmisteen käytön jälkeen ja joka korjaantui lääkevalmisteen käytön lopettamisen jälkeen. Muutamassa tällaisessa tapauksessa on kuvattu ammoniakkipitoisuuden suurenemista ja samanaikaisen fenobarbitaalin käytön yhteydessä fenobarbitaalipitoisuuden suurenemista. Yksittäistapauksissa, erityisesti suurten annosten tai muiden epilepsialääkkeiden samanaikaisen käytön yhteydessä on todettu kroonista enkefalopatiaa. Enkefalopatiatapauksiin liittyi hermosto-oireita ja aivokuoren korkeamman asteen toiminnan häiriöitä, joiden alkuperää ei myöskään voitu selittää kattavasti.

*5 Näitä haittavaikutuksia on raportoitu vain parenteraalisen annon yhteydessä.

*6 Pahoinvointia, ylävatsakipua ja ripulia ilmaantuu joillekin potilaille usein hoidon alussa. Nämä oireet häviävät yleensä muutaman päivän kuluttua eivätkä vaadi hoidon keskeyttämistä. Pahoinvointia on havaittu myös muutaman minuutin kuluttua laskimoon annetun injektion jälkeen; se häviää itsestään muutamassa minuutissa.

*7Erityistä huomiota on kiinnitettävä seuraaviin maksavaurion merkkeihin: epilepsiakohtauksia ehkäisevän vaikutuksen heikkeneminen, joka ilmenee epilepsiakohtausten uusiutumisena tai lisääntymisenä, fyysinen heikkouden tunne, ruokahaluttomuus, pahoinvointi tai toistuva oksentelu, selittämätön keskiylävatsan kipu, yleistynyt tai paikallinen turvotus, haluttomuus, tajunnantilan häiriöt ja sekavuus, levottomuus ja liikehäiriöt. Hyvin harvinaisissa tapauksissa on havaittu myös samanlaisia kliinisiä oireita aiheuttanutta haimavauriota. Lapsia ja imeväisiä tulee seurata huolellisesti näiden kliinisten oireiden varalta. Jos edellä mainitut oireet kestävät pitkään tai ovat vaikeita, perusteellisen kliinisen tutkimuksen lisäksi on tehtävä asiaankuuluvat laboratoriotutkimukset (ks. kohta Varoitukset ja käyttöön liittyvät varotoimet).

*8 Pitkään natriumvalproaattia käyttäneillä potilailla on raportoitu luun mineraalitiheyden laskua, osteopeniaa, osteoporoosia ja luunmurtumia. Mekanismia, jolla natriumvalproaatti vaikuttaa luun aineenvaihduntaan, ei tunneta.

Epäillyistä haittavaikutuksista ilmoittaminen

On tärkeää ilmoittaa myyntiluvan myöntämisen jälkeisistä lääkevalmisteen epäillyistä haittavaikutuksista. Se mahdollistaa lääkevalmisteen hyöty‐haittatasapainon jatkuvan arvioinnin. Terveydenhuollon ammattilaisia pyydetään ilmoittamaan kaikista epäillyistä haittavaikutuksista seuraavalle taholle:

www-sivusto: www.fimea.fi
Lääkealan turvallisuus- ja kehittämiskeskus Fimea
Lääkkeiden haittavaikutusrekisteri
PL 55
00034 FIMEA

Yliannostus

Myrkytystä arvioitaessa tulee ottaa huomioon usean lääkevalmisteen aiheuttaman myrkytyksen mahdollisuus esimerkiksi itsemurhayrityksissä.

Viite alueella (340 - 700 mikromol/l) valproiinihapon toksisuus on suhteellisen pieni. Kirjallisuudessa on harvoja yksittäismainintoja kuolemantapauksista akuutin ja kroonisen yliannostuksen yhteydessä.

Yliannoksen oireet

Tyypillisiä myrkytysoireita ovat sekavuus, sedaatio ja jopa syvä tajuttomuus, myastenia ja hypo- tai arefleksia. Myös hypotoniaa, mioosia, sydän-verisuonijärjestelmän ja hengitysjärjestelmän häiriöitä, aivoturvotusta, metabolista asidoosia, hypokalsemiaa ja hypernatremiaa on todettu yksittäistapauksissa. Aikuisilla ja lapsilla suuret pitoisuudet plasmassa aiheuttavat poikkeavia neurologisia reaktioita ja käyttäytymismuutoksia.

Natriumvalproaatin sisältämä natrium saattaa johtaa hypernatremiaan yliannostustapauksissa.

Yliannoksen hoito

Spesifistä antidoottia ei tunneta. Siksi hoito rajoittuu yleisiin toimiin vaikuttavan aineen poistamiseksi elimistöstä ja vitaalitoimintojen tukemiseksi. Suun kautta tapahtuneessa yliannostuksessa potilas on saatava oksentamaan tai hänelle on tehtävä mahahuuhtelu ja annettava lääkehiiltä mikäli mahdollista 30 minuutin kuluessa yliannoksen ottamisesta. Tällöin on tehokas seuranta tarpeen.

Hemodialyysi tai kiihdytetty diureesi saattavat olla hyödyksi. Peritoneaalidialyysista ei juuri ole apua.

Hematogeenisen hiiliperfuusion tai plasmanvaihdon ja verensiirron tehosta on riittämättömästi kokemusta. Tästä syystä suositellaan erityisesti lapsilla tehostettua hoitoa sairaalassa ilman erityisiä detoksifikaatiotoimia mutta plasman pitoisuutta seuraten.
Tajunnantason alenemisen on raportoitu kumoutuneen laskimoon annetulla naloksonilla.

Farmakologiset ominaisuudet

Farmakodynamiikka

Farmakoterapeuttinen ryhmä: epilepsialääkkeet, rasvahappojohdokset
ATC-koodi: N03A G01

Valproiinihappo on epilepsialääke, joka ei muistuta rakenteeltaan muita epilepsialääkkeitä. Valproiinihapon antikonvulsiivinen vaikutus on osoitettu koe-eläimillä ja ihmisillä. Vaikutustavan hyväksytty selitys on, että presynaptinen vaikutus GABA-aineenvaihduntaan ja/tai suora postsynaptinen vaikutus hermosolun solukalvon ionikanaviin lisää GABA-välitteistä inhibitiota.
Valproiinihappo liukenee huonosti veteen (1:800), ja natriumvalproaatti liukenee kohtalaisesti veteen (1:0,4).

Monilääke-kuljettajaproteiinit (MDT; Multidrug transporter protein) poistavat lääkeaineita aivoista ja tällä tavoin ne voivat vähentää epilepsialääkkeiden pitoisuuksia vaikutuskohdassa.
Monilääke-kuljettajaproteiinien yliekspressio voi johtaa lääkeaineresistenssin kehittymiseen ja sitä myötä hoitoresistentin status epilepticus-tilan‑ tai hoitoresistentin epilepsian kehittymiseen.
Prekliiniset tutkimukset osoittavat, että monilääke-kuljettajaproteiinit eivät poista valproaattia aivoista (eli se ei ole monilääke-kuljettajaproteiinin substraatti). Sen vuoksi monilääke-kuljettajaproteiinin indusoiman lääkeaineresistenssin kehittymisen ​​valproaattia vastaan katsotaan olevan epätodennäköistä.

Farmakokinetiikka

Imeytyminen

Laskimonsisäisessä annossa huippupitoisuus plasmassa saavutetaan miltei välittömästi.

Jakautuminen

Jakautumistilavuus on iästä riippuvainen ja yleensä 0,13 ‑ 0,23 l/kg, ja nuorilla 0,13 ‑ 0,19 l/kg.

Enimmillään 90 - 95 % valproiinihaposta sitoutuu plasman proteiiniin, lähinnä albumiiniin. Proteiiniinsitoutuminen vähenee suurilla annoksilla. Sitoutuminen plasman proteiiniineihin on vähäisempää iäkkäillä potilailla ja potilailla, joilla on munuaisten tai maksan vajaatoiminta. Yhdessä tutkimuksessa todettiin kohonneita vapaan vaikuttavan aineen pitoisuuksia (8,5 - yli 20 %) potilailla, joilla oli merkitsevästi heikentynyt munuaisten toiminta.

Vakaan tilan pitoisuus plasmassa saavutetaan 3 ‑ 5 päivässä, jos hoito aloitetaan ylläpitoannoksella.

Raskausaikana puhdistuma maksassa ja munuaisissa lisääntyy jakautumistilavuuden suuretessa kolmannella raskauskolmanneksella, ja pitoisuus plasmassa saattaa pienetä, vaikka annos ei muutu. Lisäksi plasman proteiiniinsitoutumisessa on havaittu muutos raskauden aikana niin, että vapaan (terapeuttisesti vaikuttavan) valproiinihapon määrä suurenee.

Kulkeutuminen istukan läpi (ks. kohta Raskaus ja imetys)
Valproaatti läpäisee istukan eri eläinlajeilla ja ihmisillä:

  • Valproaatti läpäisee istukan eri eläinlajeilla samalla tavalla kuin ihmisillä.
  • Ihmisillä on useissa julkaisuissa määritetty valproaattipitoisuuksia vastasyntyneiden napanuorasta synnytyksen yhteydessä.

Seerumin valproaattipitoisuus napanuorassa, joka vastaa pitoisuutta sikiöllä, oli yhtä suuri tai hieman suurempi kuin äideillä.

Valproiinihappo erittyy äidinmaitoon. Vakaassa tilassa pitoisuus äidinmaidossa on noin 10 % pitoisuudesta plasmassa.

Valproiinihapon pitoisuus aivoselkäydinnesteessä on 10 % kulloisestakin pitoisuudesta plasmassa.

Biotransformaatio

Biotransformaatio tapahtuu glukuronidaation ja beeta-, omega- ja omega-1-oksidaation kautta. Noin 20 % annetusta annoksesta erittyy virtsaan glukuronidiesterinä. Metaboliitteja on yli 20, ja omegaoksidaation tuloksena syntyviä pidetään maksatoksisina. Alle 5 % annetusta valproiinihappoannoksesta erittyy muuttumattomana virtsaan. Päämetaboliitti on 3-keto-valproiinihappo, josta 3 ‑ 60 % erittyy virtsaan.

Eliminaatio

Terveillä henkilöillä plasmapuhdistuma on 5 - 10 ml/min; puhdistuma nopeutuu jos käytetään entsyymi-induktiota aiheuttavia epilepsialääkkeitä (epilepsiapotilailla mitattiin 12,7 ml/min). Yksinään käytettynä tämän vaikuttavan aineen puoliintumisaika plasmassa on keskimäärin 12 ‑ 16 tuntia, mikä ei muutu pitkäaikaishoidon aikana.

Plasman puoliintumisaika on vastasyntyneillä ja imeväisillä 18 kuukauteen asti 10 ‑ 67 tuntia. Pisin puoliintumisaika todettiin heti syntymän jälkeen; yli 2 kuukauden iästä eteenpäin arvot lähestyvät aikuisten arvoja.

Puoliintumisaika pitenee potilailla, joilla on maksasairaus. Yliannostuksen yhteydessä on todettu yli 30 tunnin puoliintumisaikoja.

Lineaarisuus/ei-lineaarisuus

Annoksen ja plasman pitoisuuksien suhde on lineaarinen. Suoraa yhteyttä plasman valproiinihappopitoisuuksien ja tehokkuuden välillä ei ole, mutta viitealueeksi katsotaan yleensä 340 ‑ 700 mikromol/l. Pitoisuuden ollessa yli 700 mikromol/l voidaan odottaa haittavaikutusten lisääntymistä.

Prekliiniset tiedot turvallisuudesta

Krooninen toksisuus

Kivesatrofiaa, vas deferensin degeneraatiota ja puutteellista spermatogeneesiä sekä keuhkojen ja eturauhasen muutoksia on havaittu kroonisissa toksisuustutkimuksissa rotalla ja koiralla. Näiden löydösten kliinistä merkitystä ei tiedetä.

Valproiinihappo on todettu teratogeeniseksi hiirellä, rotalla ja kaniinilla. Mutageenisuustutkimuksissa ei ole todettu mutageenisia vaikutuksia. Karsinogeenisuustutkimuksissa rotalla ja hiirellä havaittiin urosrotilla suuria annoksia käytettäessä ihonalaisen fibrosarkooman lisääntynyttä esiintyvyyttä.

Eläinkokeissa on havaittu, että valproaatille altistuminen kohdussa johtaa kuulojärjestelmän morfologisiin ja toiminnallisiin muutoksiin rotilla ja hiirillä.

Farmaseuttiset tiedot

Apuaineet

Dinatriumedetaatti, natriumhydroksidi „pH:n säätämiseen“, väkevä kloorivetyhappo „pH:n säätämiseen“, injektionesteisiin käytettävä vesi

Yhteensopimattomuudet

Orfiril-injektionestettä ei tule antaa samalla siirtoletkulla muiden lääkevalmisteiden kanssa eikä sekoittaa muiden lääkevalmisteiden kanssa, lukuun ottamatta niitä, jotka mainitaan kohdassa Käyttö- ja käsittelyohjeet.

Kestoaika

3 vuotta

Laimennetun liuoksen on osoitettu pysyvän kemiallisesti ja fysikaalisesti stabiilina käytön aikana 3 päivää 20 ‑ 22 °C:ssa. Mikrobiologiselta kannalta laimennettu liuos tulee käyttää heti. Jos sitä ei käytetä heti, säilytysaika ja olosuhteet ovat käyttäjän vastuulla eivätkä ne yleensä saa ylittää 24 tuntia 2 - 8 °C:ssa, ellei laimentaminen tapahdu kontrolloiduissa ja validoiduissa antiseptisissä olosuhteissa.

Säilytys

Ei saa jäätyä.

Laimennetun lääkevalmisteen säilytys, ks. kohta Kestoaika.

Pakkaukset ja valmisteen kuvaus

Markkinoilla olevat pakkaukset

Resepti

ORFIRIL injektioneste, liuos
100 mg/ml 5 x 3 ml (35,05 €)

PF-selosteen tieto

5 värittömästä lasista valmistettua pistekatkaisuampullia, joissa on sisäpuolella silikonipinnoite ja jotka sisältävä 3 ml/10 ml injektionestettä

Valmisteen kuvaus:

Kirkas, väritön liuos.

Käyttö- ja käsittelyohjeet

Orfiril-injektioneste on käyttövalmis. Se voidaan antaa hitaana injektiona laskimoon tai laskimoinfuusiona laimennettuna 9 mg/ml (0,9 %) natriumkloridi- tai 50 mg/ml (5 %) glukoosiliuokseen. Laimennuksessa on noudatettava aseptista tekniikkaa.

Orfiril 100 mg/ml injektioneste on kertakäyttöinen. Käyttämätön injektioneste on hävitettävä.

Ennen käyttöä laimennettu injektioneste tulee tarkastaa silmämääräisesti. Vain kirkasta nestettä, jossa ei ole hiukkasia, tulee käyttää.

Korvattavuus

ORFIRIL injektioneste, liuos
100 mg/ml 5 x 3 ml

  • Ei korvausta.

ATC-koodi

N03AG01

Valmisteyhteenvedon muuttamispäivämäärä

23.03.2020

Yhteystiedot

BIOCODEX OY
Metsänneidonkuja 8
02130 Espoo


09 329 59100
www.biocodex.fi
info@biocodex.fi